Web stats for Aniruddha - aniruddha.tv
Official website of Aniruddha TV
1.67 Rating by ClearWebStats
This website is a sub-domain of tv. This website has a #1,476,708 rank in global traffic. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, aniruddha.tv is SAFE to browse.
Traffic Report of Aniruddha
Daily Unique Visitors: | 326 |
Daily Pageviews: | 652 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,476,708 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
85
Siteadvisor Rating
Not Applicable
Where is aniruddha.tv server located?
Social Engagement
Facebook Shares: | 522 |
Facebook Likes: | 2,089 |
Facebook Comments: | 152 |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 11 |
Google Adsense: | Not Applicable | Google Analytics: | UA-54296074-1 |
Websites Hosted on Same IP (i.e. 23.229.144.132)
Regenerative Medicine and Cosmetic Surgery
- regenestemasia.com
International Medical company that focused on providing the most comprehensive & up to date stem cell regeneration across Asia & United States.
Daily Inspirations and Motivations | Daily Fitness, Yoga, Tattoo Inspirations and Motivations Photos
- inspimoti.com
Black Sunday Sale
- blacksundaysale.com
Amerikalılar’ın Black Friday’i varsa bizim de Black Sunday ’imiz var! Black Sunday Sale satış etkinliği.
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 08 Aug 2016 04:56:01 GMT
Server: Apache
X-Powered-By: PHP/5.4.45
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 4593
Content-Type: text/html
Status-Code: 200
Status: 200 OK
Date: Mon, 08 Aug 2016 04:56:01 GMT
Server: Apache
X-Powered-By: PHP/5.4.45
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 4593
Content-Type: text/html
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
aniruddha.tv | A | 600 |
IP:23.229.144.132 |
aniruddha.tv | NS | 3600 |
Target:ns68.domaincontrol.com |
aniruddha.tv | NS | 3600 |
Target:ns67.domaincontrol.com |
aniruddha.tv | SOA | 3600 |
MNAME:ns67.domaincontrol.com RNAME:dns.jomax.net Serial:2016050400 Refresh:28800 Retry:7200 Expire:604800 |
aniruddha.tv | MX | 3600 |
Target:mail.aniruddha.tv |
aniruddha.tv | TXT | 3600 |
TXT:v=spf1 a mx ptr include:secureserver.net include:spf.mandrillapp.com ~all |
Similarly Ranked Websites to Aniruddha
בשמים KOKO Perfume בושם לגבר בושם לאישה UA-53425768-1
- koko.co.il
בשמים KOKO Perfume בושם לאשה לגבר בושם לאישה במבצע מגוון קלווין קליין chanel בולגארי אליאן alien coco קוקו
شركة كشف تسربات المياه بالرياض (الموقع للايجار
- companydetectleakswaterinriyadh.com
شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من